CCL5 Protein, Human, Recombinant (Active)

Catalog Number: orb2816356

Catalog Number	orb2816356
Category	Proteins
Description	CCL5 Protein, Human, Recombinant (Active) is expressed in E. coli with Tag Free. The accession number is P13501.
Tag	Tag Free
MW	7.8 kDa (Predicted)
UniProt ID	P13501
Protein Sequence	SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS
Expression System	E. coli
Biological Origin	Human
Expression Region	24-91 aa
Storage	-20°C
Note	For research use only
Application notes	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Expiration Date	6 months from date of receipt.

Item 1 of 1
Human CCL5 protein (Active) [orb359071]
Purity:
> 98% as determined by SDS-PAGE and HPLC.
MW:
7.8 kDa
Source:
E.Coli
Sizes Available: 5 μg, 100 μg, 500 μg
Recombinant Human C-C motif chemokine 5 protein(CCL5) (Active) [orb1650792]
Sizes Available: 100 μg, 5 μg, 20 μg, 1 mg, 250 μg, 500 μg
Recombinant Murine Macrophage Inflammatory Protein-1 gamma/ CCL9/10 (rMuCCL9/10) [orb1494921]
Purity:
> 95% by SDS-PAGE and HPLC analyses.
MW:
Approximately 11.5 kDa, a single non-glycosylated polypeptide chain containing 101 amino acids.
Source:
Escherichia coli.
Sizes Available: 1 mg, 20 μg, 5 μg

Purity:	> 98% as determined by SDS-PAGE and HPLC.
MW:	7.8 kDa
Source:	E.Coli

Purity:	> 95% by SDS-PAGE and HPLC analyses.
MW:	Approximately 11.5 kDa, a single non-glycosylated polypeptide chain containing 101 amino acids.
Source:	Escherichia coli.