You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb579285 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to CCDC90A |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human CCDC90A |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 40kDa |
Target | MCUR1 |
UniProt ID | Q96AQ8 |
Protein Sequence | Synthetic peptide located within the following region: ELHQLKQQVMDEVIKVRTDTKLDFNLEKSRVKELYSLNEKKLLELRTEIV |
NCBI | NP_001026883 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | FMP32, C6orf79, CCDC90A Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: CCDC90A, Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 3 ug/ml.
Host: Rabbit, Target Name: CCDC90A, Sample Type: Human Fetal Lung, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5 ug/ml, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 0.12.
Host: Rabbit, Target Name: MCUR1, Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 1 ug/ml.
Host: Rabbit, Target Name: MCUR1, Sample Type: OVCAR-3 Cell lysates, Antibody Dilution: 1.0 ug/ml.
WB Suggested Anti-CCDC90A Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Human brain.
ELISA, IF, IHC-Fr, IHC-P | |
Bovine, Canine, Equine, Gallus, Human, Mouse, Rat, Sheep | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P | |
Bovine, Canine, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating