You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb381052 |
---|---|
Category | Antibodies |
Description | CCDC6 Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | FC, ICC, IF, WB |
Predicted Reactivity | Bovine, Canine, Equine, Gallus, Hamster, Monkey, Rabbit, Zebrafish |
Reactivity | Human, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human CCDC6 (156-198aa KAELEQHLEQEQEFQVNKLMKKIKKLENDTISKQLTLEQLRR E), identical to the related mouse sequence. |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 53291 MW |
UniProt ID | Q16204 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Coiled-coil domain-containing protein 6;Papillary Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
Flow Cytometry analysis of CACO-2 cells using anti-CCDC6 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.
WB analysis of CCDC6 using anti-CCDC6 antibody.Lane 1:rat testis tissue; 2:MCF-7 cell.
IF analysis of CCDC6 using anti-CCDC6 antibody. CCDC6 was detected in immunocytochemical section of T-47D cells.
IF, IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating