CBS purified MaxPab rabbit polyclonal antibody (D01P)

• Catalog Number: orb2295000
• Category: Antibodies
• Description: Rabbit polyclonal antibody raised against a full-length human CBS protein.
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Reactivity: Human, Mouse
• Immunogen: CBS (NP_000062.1, 1 a.a. ~ 551 a.a) full-length human protein.
• Conjugation: Unconjugated
• Protein Sequence: MPSETPQAEVGPTGCPHRSGPHSAKGSLEKGSPEDKEAKEPLWIRPDAPSRCTWQLGRPASESPHHHTAPAKSPKILPDILKKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERDGTLKPGDTIIEPTSGNTGIGLALAAAVRGYRCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEILQQCDGKLDMLVASVGTGGTITGIARKLKEKCPGCRIIGVDPEGSILAEPEELNQTEQTTYEVEGIGYDFIPTVLDRTVVDKWFKSNDEEAFTFARMLIAQEGLLCGGSAGSTVAVAVKAAQELQEGQRCVVILPDSVRNYMTKFLSDRWMLQKGFLKEEDLTEKKPWWWHLRVQELGLSAPLTVLPTITCGHTIEILREKGFDQAPVVDEAGVILGMVTLGNMLSSLLAGKVQPSDQVGKVIYKQFKQIRLTDTLGRLSHILEMDHFALVVHEQIQYHSTGKSSQRQMVFGVVTAIDLLNFVAAQERDQK
• NCBI: NP_000062.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

CBS MaxPab rabbit polyclonal antibody. Western Blot analysis of CBS expression in human pancreas.

CBS MaxPab rabbit polyclonal antibody. Western Blot analysis of CBS expression in mouse kidney.

Western Blot analysis of CBS expression in transfected 293T cell line by CBS MaxPab polyclonal antibody. Lane 1: CBS transfected lysate(60.60 KDa). Lane 2: Non-transfected lysate.