CBS monoclonal antibody (M07), clone 5F7

• Catalog Number: orb2294995
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant CBS.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 5F7
• Tested applications: ELISA, IF, IHC-P, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: CBS (NP_000062, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MPSETPQAEVGPTGCPHRSGPHSAKGSLEKGSPEDKEAKEPLWIRPDAPSRCTWQLGRPASESPHHHTAPAKSPKILPDILKKIGDTPMVRINKIGKKFG
• NCBI: NP_000062
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged CBS is approximately 0.03 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to CBS on HeLa cell. [antibody concentration 15 ug/ml].

Immunoperoxidase of monoclonal antibody to CBS on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 3 ug/ml].

Western Blot detection against Immunogen (36.74 KDa).