CBR1 purified MaxPab mouse polyclonal antibody (B01P)

• Catalog Number: orb2295014
• Category: Antibodies
• Description: Mouse polyclonal antibody raised against a full-length human CBR1 protein.
• Species/Host: Mouse
• Clonality: Polyclonal
• Tested applications: WB
• Reactivity: Human
• Immunogen: CBR1 (NP_001748.1, 1 a.a. ~ 277 a.a) full-length human protein.
• Conjugation: Unconjugated
• Protein Sequence: MSSGIHVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGLSPRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPSSAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW
• NCBI: NP_001748.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

CBR1 MaxPab polyclonal antibody. Western Blot analysis of CBR1 expression in HeLa.

CBR1 MaxPab polyclonal antibody. Western Blot analysis of CBR1 expression in human liver.

Western Blot analysis of CBR1 expression in transfected 293T cell line by CBR1 MaxPab polyclonal antibody. Lane 1: CBR1 transfected lysate(30.47 KDa). Lane 2: Non-transfected lysate.