You have no items in your shopping cart.
Cart summary
CBR1 Protein, Human, Recombinant (E. coli, His)
Catalog Number: orb1978875
| Catalog Number | orb1978875 |
|---|---|
| Category | Proteins |
| Description | CBR1 Protein, Human, Recombinant (E. coli, His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 34.2?kDa and the accession number is P16152. |
| Tag | N-6xHis |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| MW | 34.2?kDa (predicted) |
| UniProt ID | P16152 |
| Protein Sequence | SSGIHVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGLSPRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPSSAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW |
| Expression System | E. coli |
| Biological Origin | Human |
| Biological Activity | CBR1 Protein, Human, Recombinant (E. coli, His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 34.2?kDa and the accession number is P16152. |
| Expression Region | 45-320 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
