You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb574530 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to CASZ1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Equine, Guinea pig, Human, Rat |
Reactivity | Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human CASZ1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 125kDa |
Target | CASZ1 |
UniProt ID | Q86V15 |
Protein Sequence | Synthetic peptide located within the following region: TPARFPPAQVKPEPGESTGAPGPHEASQDRSLDLTVKEPSNESNGHAVPA |
NCBI | NP_060236 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | CST, SRG, CAS11, ZNF693, dJ734G22.1 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Mouse, Target Name: CASZ1, Sample Tissue: Mouse Pancreas, Antibody dilution: 1 ug/ml.
WB Suggested Anti-CASZ1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Transfected 293T.
Filter by Rating