CASP1 monoclonal antibody (M01), clone 3D2

• Catalog Number: orb2295098
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant CASP1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 3D2
• Tested applications: ELISA, IHC-P, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: CASP1 (AAH62327, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MADKVLKEKRKLFIRSMGEAPQAVQDNPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLL
• NCBI: AAH62327
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged CASP1 is approximately 0.1 ng/ml as a capture antibody.

Immunoperoxidase of monoclonal antibody to CASP1 on formalin-fixed paraffin-embedded human hepatocellular carcinoma. [antibody concentration 3 ug/ml].

Western Blot analysis of CASP1 expression in transfected 293T cell line by CASP1 monoclonal antibody (M01), clone 3D2. Lane 1: CASP1 transfected lysate(35 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.63 KDa).