You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1216235 |
---|---|
Category | Proteins |
Description | The Canine IL-1 Receptor Antagonist yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Canine IL-1 Receptor Antagonist applications are for cell culture, ELISA standard, and Western Blot Control. The Canine IL-1 Receptor Antagonist yeast-derived recombinant protein can be purchased in multiple sizes. Canine IL-1 Receptor Antagonist Specifications: (Molecular Weight: 16.8 kDa) (Amino Acid Sequence: LGKRPCRMQAFRIWDVNQKTFYLRNNQLVAGYLQGSNTKLEEKLDVVPVEPHAVFLGIHGGKLCLACVKSGDETRLQLEAVNITDLSKNKDQDKRFTFILSDSGPTTSFESAACPGWFLCTALEADRPVSLTNRPEEAMMVTKFYFQKE (149)) (Gene ID: 403660). |
Form/Appearance | Lyophilized |
Purity | 98% |
MW | 16.8 kDa |
Target | IL-1ra |
Entrez | 403660 |
Protein Sequence | LGKRPCRMQAFRIWDVNQKTFYLRNNQLVAGYLQGSNTKLEEKLDVVPVEPHAVFLGIHGGKLCLACVKSGDETRLQLEAVNITDLSKNKDQDKRFTFILSDSGPTTSFESAACPGWFLCTALEADRPVSLTNRPEEAMMVTKFYFQKE (149) |
Protein Length | 149 |
Source | Yeast |
Storage | -20°C |
Alternative names | IL-1F3 Read more... |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
Filter by Rating