You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1216214 |
---|---|
Category | Proteins |
Description | The Canine IL-1 alpha yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Canine IL-1 alpha applications are for cell culture, ELISA standard, and Western Blot Control. The Canine IL-1 alpha yeast-derived recombinant protein can be purchased in multiple sizes. Canine IL-1 alpha Specifications: (Molecular Weight: 18.2 kDa) (Amino Acid Sequence: SVAYNFHNNE KYNYIRIIKS QFILNDNLNQ SIVRQTGGNY LMTAALQNLD DAVKFDMGAY TSEDSKLPVT LRISKTRLFV SAQNEDEPVL LKEMPETPKT IRDETNLLFF WERHGSKHYF KSVAQPKLFI ATQERKLVHM ARGQPSITDF RLLETQP (157)) (Gene ID: 403782). |
Form/Appearance | Lyophilized |
Purity | 98% |
MW | 18.2 kDa |
Target | IL-1 alpha |
Entrez | 403782 |
Protein Sequence | SVAYNFHNNEKYNYIRIIKSQFILNDNLNQSIVRQTGGNYLMTAALQNLDDAVKFDMGAYTSEDSKLPVTLRISKTRLFVSAQNEDEPVLLKEMPETPKTIRDETNLLFFWERHGSKHYFKSVAQPKLFIATQERKLVHMARGQPSITDFRLLETQP (157) |
Protein Length | 157 |
Source | Yeast |
Storage | -20°C |
Alternative names | IL-1F1 Read more... |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
Filter by Rating