You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb581980 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to CAMKK2 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human CAMKK2 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 55kDa |
Target | CAMKK2 |
UniProt ID | Q96RR4 |
Protein Sequence | Synthetic peptide located within the following region: GGLAAGGSLDMNGRCICPSLPYSPVSSPQSSPRLPRRPTVESHHVSITGM |
NCBI | NP_705720 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | CAMKK, CAMKKB Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Tissue: Human A549 Whole Cell, Antibody dilution: 3 ug/ml.
Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.
Sample Type: Human Fetal Liver, Antibody dilution: 1.0 ug/ml.
Sample Type: Human Hela, Antibody dilution: 1.0 ug/ml. There is BioGPS gene expression data showing that CAMKK2 is expressed in HeLa.
Sample Type: Human HepG2, Antibody dilution: 1.0 ug/ml. There is BioGPS gene expression data showing that CAMKK2 is expressed in HepG2.
Sample Type: Human Jurkat, Antibody dilution: 1.0 ug/ml. CAMKK2 is supported by BioGPS gene expression data to be expressed in Jurkat.
Sample Type: Human MCF7, Antibody dilution: 1.0 ug/ml. CAMKK2 is supported by BioGPS gene expression data to be expressed in MCF7.
WB Suggested Anti-CAMKK2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: 721_B cell lysate. There is BioGPS gene expression data showing that CAMKK2 is expressed in 721_B.
ELISA, IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating