CALR Antibody

• Catalog Number: orb573585
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CALR
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Yeast, Zebrafish
• Reactivity: Animal, Canine, Goat, Guinea pig, Human, Mouse, Rat, Yeast, Zebrafish
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CALR
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 48kDa
• Target: CALR
• UniProt ID: P27797
• Protein Sequence: Synthetic peptide located within the following region: FGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDEDK
• NCBI: NP_004334
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: RO, CRT, SSA, cC1qR, HEL-S-99n
• Note: For research use only
• Expiration Date: 12 months from date of receipt.