You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb389393 |
---|---|
Category | Antibodies |
Description | Calpastatin/CAST Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | FC, ICC, IF, IHC, WB |
Reactivity | Human |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence in the middle region of human Calpastatin (275-310aa QEKKRKVEKDTMSDQALEALSASLGTRQAEPELDLR), different from the related mouse sequence by fifteen amino acids, and from the related rat sequence by eleven amino |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 76573 MW |
UniProt ID | P20810 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Calpastatin;Calpain inhibitor;Sperm BS-17 componen Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
Flow Cytometry analysis of U20S cells using anti-Calpastatin antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.
Flow Cytometry analysis of A549 cells using anti-Calpastatin antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.
Flow Cytometry analysis of A431 cells using anti-Calpastatin antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.
WB analysis of Calpastatin using anti-Calpastatin antibody.Lane 1:human HeLa cell; 2:human Hacat cell.
IF analysis of Calpastatin using anti-Calpastatin antibody. Calpastatin was detected in immunocytochemical section of U20S cells.
IHC analysis of Calpastatin using anti-Calpastatin antibody.Calpastatin was detected in paraffin-embedded section of human intetsinal cancer tissues.
IHC analysis of Calpastatin using anti-Calpastatin antibody.Calpastatin was detected in paraffin-embedded section of human placenta tissues.
IHC-P, WB | |
Bovine, Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating