CALM3 antibody

• Catalog Number: orb584401
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CALM3
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Porcine, Rat
• Reactivity: Human
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 12kDa
• Target: CALM3
• UniProt ID: P62158
• Protein Sequence: Synthetic peptide located within the following region: LQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGN
• NCBI: EAW57427
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: CaM, CALM, CAM1, CAM2, CAMB, PHKD, CPVT6, LQT16, P
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target Name: CALM3, Sample Type: Human 721_B, Antibody dilution: 1.0 ug/ml. CALM3 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.

Host: Rabbit, Target Name: CALM3, Sample Type: Human HepG2, Antibody dilution: 1.0 ug/ml. CALM3 is supported by BioGPS gene expression data to be expressed in HepG2.

Host: Rabbit, Target Name: CALM3, Sample Type: Human Jurkat, Antibody dilution: 1.0 ug/ml. CALM3 is strongly supported by BioGPS gene expression data to be expressed in Jurkat.

Host: Rabbit, Target Name: CALM3, Sample Type: Human MCF7, Antibody dilution: 1.0 ug/ml. CALM3 is strongly supported by BioGPS gene expression data to be expressed in MCF7.