CALCRL antibody

• Catalog Number: orb578405
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CALCRL
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CALCRL
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 53kDa
• Target: CALCRL
• UniProt ID: Q16602
• Protein Sequence: Synthetic peptide located within the following region: DGNWFRHPASNRTWTNYTQCNVNTHEKVKTALNLFYLTIIGHGLSIASLL
• NCBI: NP_005786
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: CRLR, CGRPR, LMPHM8
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target Name: CALCRL, Sample Tissue: Human 786-0 Whole Cell, Antibody Dilution: 3 ug/ml.

Host: Rabbit, Target Name: CALCRL, Sample Tissue: Human Lung Tumor, Antibody Dilution: 1 ug/ml.

Host: Rabbit, Target Name: CALCRL, Sample Tissue: Human Ovary Tumor, Antibody Dilution: 1 ug/ml.

WB Suggested Anti-CALCRL Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: Human Muscle.