You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb326210 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to CALCOCO1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human CALCOCO1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 77kDa |
Target | CALCOCO1 |
UniProt ID | Q9P1Z2 |
Protein Sequence | Synthetic peptide located within the following region: ESTTDGSPIHTSVQFQASYLPKPGAQLYQFRYVNRQGQVCGQSPPFQFRE |
NCBI | NP_065949 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti Cocoa antibody, anti KIAA1536 antibody, anti Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Western blot analysis of Jurkat cell lysate tissue using CALCOCO1 antibody
WB Suggested Anti-CALCOCO1 Antibody Titration: 0.2-1 ug/mL, Positive Control: Jurkat cell lysate.
Filter by Rating