You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb329801 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to CACNA2D1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat |
Reactivity | Canine, Equine, Guinea pig, Human, Mouse, Rat |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human CACNA2D1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 120kDa |
Target | CACNA2D1 |
UniProt ID | P54289 |
Protein Sequence | Synthetic peptide located within the following region: PKSQEPVTLDFLDAELENDIKVEIRNKMIDGESGEKTFRTLVKSQDERYI |
NCBI | NP_000713 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti CACNA2 antibody, anti CCHL2A antibody, anti C Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Western blot analysis of Fetal Muscle tissue using CACNA2D1 antibody
Western blot analysis of human Muscle tissue using CACNA2D1 antibody
Host: Rabbit, Target Name: CACNA2D1, Sample Tissue: Human A549 Whole Cell, Antibody Dilution: 3 ug/mL.
Host: Rabbit, Target Name: CACNA2D1, Sample Type: Fetal Muscle, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/mL, Peptide Concentration: 5 ug/mL, Lysate Quantity: 25 ug/lane/Lane, Gel Concentration: 0.12.
Host: Rabbit, Target: CACNA2D1, Positive control (+): Human Liver (LI), Negative control (-): MCF7 Cell Lysate (N10), Antibody concentration: 3 ug/mL.
WB Suggested Anti-CACNA2D1 Antibody Titration: 0.12 ug/mL, ELISA Titer: 1:312500, Positive Control: Human Muscle.
ELISA, IF, IHC | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating