You have no items in your shopping cart.
Cart summary
C3L Recombinant Protein
Catalog Number: orb2055521
| Catalog Number | orb2055521 |
|---|---|
| Category | Proteins |
| Description | C3L Recombinant Protein |
| Species/Host | Virus |
| Tag | N-terminal 6xHis-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 28.6 kDa |
| UniProt ID | P68638 |
| Protein Sequence | CCTIPSRPINMKFKNSVETDANANYNIGDTIEYLCLPGYRKQKMGPIYAKCTGTGWTLFNQCIKRRCPSPRDIDNGQLDIGGVDFGSSITYSCNSGYHLIGESKSYCELGSTGSMVWNPEAPICESVKCQSPPSISNGRHNGYEDFYTDGSVVTYSCNSGYSLIGNSGVLCSGGEWSDPPTCQIVKCPHPTISNGYLSSGFKRSYSYNDNVDFKCKYGYKLSGSSSSTCSPGNTWKPELPKCVR |
| Source | Yeast |
| NCBI | YP_232907.1 |
| Storage | -20°C or -80°C |
| Buffer/Preservatives | Liquid or Lyophilized powder |
| Alternative names | 28 kDa protein;secreted complement-binding protein Read more... |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
Viral C3L protein [orb358466]
Greater than 90% as determined by SDS-PAGE.
28.6 kDa
Yeast
20 μg, 100 μg, 1 mgC3L Recombinant Protein [orb2055523]
Greater than 90% as determined by SDS-PAGE.
28.6 kDa
Yeast
100 μg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars
