You have no items in your shopping cart.
Cart summary
Item 1 of 1
C1qtnf2 antibody
Catalog Number: orb325740
| Catalog Number | orb325740 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to C1qtnf2 |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | WB |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat |
| Reactivity | Mouse |
| Concentration | 0.5 mg/ml |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| MW | 32kDa |
| Target | C1qtnf2 |
| UniProt ID | Q9D8U4 |
| Protein Sequence | Synthetic peptide located within the following region: KKGPKGKKGEPGLPGPCSCGSSRAKSAFSVAVTKSYPRERLPIKFDKILM |
| NCBI | NP_081255 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Alternative names | anti 1810033K05Rik antibody, anti CTRP2 antibody Read more... |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
WB Suggested Anti-C1qtnf2 Antibody, Titration: 1.0 ug/mL, Positive Control: Mouse Kidney.
- Item 1 of 3
- Item 1 of 2
C1QTNF2 Antibody [orb1239943]
ELISA, IHC-P, WB
Human, Mouse
Rabbit
Polyclonal
Unconjugated
0.1 mg, 0.02 mg - Item 1 of 1
- Item 1 of 1
- Item 1 of 1
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars
