You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb581208 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to C19orf2 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human C19orf2 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 55kDa |
Target | URI1 |
UniProt ID | Q6NX55 |
Protein Sequence | Synthetic peptide located within the following region: NGEYVPRKSILKSRSRENSVCSDTSESSAAEFDDRRGVLRSISCEEATCS |
NCBI | NP_604431 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | RMP, URI, NNX3, C19orf2, PPP1R19 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: URI1, Sample Type: Hela, Antibody dilution: 1.0 ug/ml. There is BioGPS gene expression data showing that URI1 is expressed in HeLa.
Host: Rabbit, Target Name: URI1, Sample Type: HepG2, Antibody dilution: 1.0 ug/ml. There is BioGPS gene expression data showing that URI1 is expressed in HepG2.
Host: Rabbit, Target Name: URI1, Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: URI1, Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: URI1, Sample Type: MCF7, Antibody dilution: 1.0 ug/ml. There is BioGPS gene expression data showing that URI1 is expressed in MCF7.
WB Suggested Anti-C19orf2 Antibody Titration: 0.2-1 ug/ml, Positive Control: Human Muscle.
ELISA, FC, WB | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating