C12orf10 antibody

• Catalog Number: orb326612
• Category: Antibodies
• Description: Rabbit polyclonal antibody to C12orf10
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Equine, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human C12orf10
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 41kDa
• Target: C12orf10
• UniProt ID: Q86UA3
• Protein Sequence: Synthetic peptide located within the following region: PLYTRHRMLGPESVPPPKRSRSKLMAPPRIGTHNGTFHCDEALACALLRL
• NCBI: NP_067653
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti MST024 antibody, anti MSTP024 antibody, anti
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target: C12ORF10, Positive control (+): HepG2 Cell Lysate (HG), Negative control (-): Human Fetal Heart (HE), Antibody concentration: 1 ug/mL.

WB Suggested Anti-C12orf10 Antibody, Titration: 1.0 ug/mL, Positive Control: 293T Whole Cell, C12orf10 is supported by BioGPS gene expression data to be expressed in HEK293T.