c-Rel Antibody

• Catalog Number: orb316604
• Category: Antibodies
• Description: c-Rel Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence in the middle region of mouse c-Rel (268-306aa DQEVSESMDFRYLPDEKDAYGNKSKKQKTTLIFQKLLQD), different from the related human sequence by four amino acids.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 64960 MW
• UniProt ID: P15307
• Sensitivity: > 5000 cells
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Proto-oncogene c-Rel;Rel;
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

WB analysis of c-Rel using anti-c-Rel antibody.Lane 1:human THP-1 cell; 2:rat spleen tissue; 3:mouse thymus tissue.

IHC analysis of c-Rel using anti-c-Rel antibody. c-Rel was detected in a paraffin-embedded section of rat Intestine tissue.

IHC analysis of c-Rel using anti-c-Rel antibody. c-Rel was detected in a paraffin-embedded section of mouse Intestine tissue.

IHC analysis of c-Rel using anti-c-Rel antibody. c-Rel was detected in a paraffin-embedded section of human mammary cancer tissue.