You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb316604 |
---|---|
Category | Antibodies |
Description | c-Rel Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Reactivity | Human, Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence in the middle region of mouse c-Rel (268-306aa DQEVSESMDFRYLPDEKDAYGNKSKKQKTTLIFQKLLQD), different from the related human sequence by four amino acids. |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 64960 MW |
UniProt ID | P15307 |
Sensitivity | > 5000 cells |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Proto-oncogene c-Rel;Rel; Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
WB analysis of c-Rel using anti-c-Rel antibody.Lane 1:human THP-1 cell; 2:rat spleen tissue; 3:mouse thymus tissue.
IHC analysis of c-Rel using anti-c-Rel antibody. c-Rel was detected in a paraffin-embedded section of rat Intestine tissue.
IHC analysis of c-Rel using anti-c-Rel antibody. c-Rel was detected in a paraffin-embedded section of mouse Intestine tissue.
IHC analysis of c-Rel using anti-c-Rel antibody. c-Rel was detected in a paraffin-embedded section of human mammary cancer tissue.
ELISA, IHC-P, WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating