You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb584054 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to BUB3 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IF, IHC, WB |
Predicted Reactivity | Bovine, Equine, Guinea pig, Rabbit, Rat |
Reactivity | Human, Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human BUB3 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 36kDa |
Target | BUB3 |
UniProt ID | A6NJ42 |
Protein Sequence | Synthetic peptide located within the following region: MTGSNEFKLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSMR |
NCBI | NP_001007794 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | BUB3L, hBUB3 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Mouse, Target Name: BUB3, Sample Tissue: Mouse Liver, Antibody dilution: 1 ug/ml.
Host: Rabbit, Target Name: BUB3, Sample Type: 293T, Antibody dilution: 1.0 ug/ml. BUB3 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells.
Rabbit Anti-BUB3 Antibody, Catalog Number: orb584054, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Nucleus, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
Sample Type: HCT116, Primary Antibody dilution: 4 ug/ml, Secondary Antibody: Anti-rabbit Alexa 546, Secondary Antibody dilution: 2 ug/ml, Gene Name: BUB3.
WB Suggested Anti-BUB3 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: PANC1 cell lysate. BUB3 is strongly supported by BioGPS gene expression data to be expressed in PANC1.
ICC, IHC, IHC-Fr, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IH, WB | |
Human, Mouse, Primate, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, ICC, IF, WB | |
Bovine | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating