You have no items in your shopping cart.
Cart summary
BTN3A1 Protein, Human, Recombinant (Yeast, His)
Catalog Number: orb1978894
| Catalog Number | orb1978894 |
|---|---|
| Category | Proteins |
| Description | Plays a role in T-cell activation and in the adaptive immune response. Regulates the proliferation of activated T-cells. Regulates the release of cytokines and IFNG by activated T-cells. Mediates the response of T-cells toward infected and transformed cells that are characterized by high levels of phosphorylated metabolites, such as isopentenyl pyrophosphate. BTN3A1 Protein, Human, Recombinant (Yeast, His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 26.2 kDa and the accession number is O00481. |
| Tag | N-6xHis |
| Purity | 98.00% |
| MW | 26.2 kDa (predicted) |
| UniProt ID | O00481 |
| Protein Sequence | QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSDLHVDVKGYKDGGIHLECRSTGWYPQPQIQWSNNKGENIPTVEAPVVADGVGLYAVAASVIMRGSSGEGVSCTIRSSLLGLEKTASISIADPFFRSAQRWIAALAG |
| Expression System | P. pastoris (Yeast) |
| Biological Origin | Human |
| Biological Activity | Plays a role in T-cell activation and in the adaptive immune response. Regulates the proliferation of activated T-cells. Regulates the release of cytokines and IFNG by activated T-cells. Mediates the response of T-cells toward infected and transformed cells that are characterized by high levels of phosphorylated metabolites, such as isopentenyl pyrophosphate. BTN3A1 Protein, Human, Recombinant (Yeast, His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 26.2 kDa and the accession number is O00481. |
| Expression Region | 30-254 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
