BRD9 antibody

• Catalog Number: orb575272
• Category: Antibodies
• Description: Rabbit polyclonal antibody to BRD9
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human BRD9
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 53kDa
• Target: BRD9
• UniProt ID: Q9H8M2
• Protein Sequence: Synthetic peptide located within the following region: VTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMMSKQAALLGNE
• NCBI: NP_001009877
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: PRO9856, LAVS3040
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target: BRD9, Positive control (+): HeLa Cell Lysate (HL), Negative control (-): Human Kidney (KI), Antibody concentration: 2.5 ug/ml.

Lanes: 1: 60 ug mouse melanocytes (melba), 2: 60 ug mouse melanoma (B16), 3: 60 ug human melanocytes (HFSC), 4: 60 ug human melanoma (SK-MEL5), 5: 60 ug human melanoma (YUMAC), 6: 60 ug rat shwann cell, Primary Antibody dilution: 1:200, Secondary Antibody: Donkey anti-rabbit HPRT, Secondary Antibody dilution: 1:2000, Gene Name: BRD9.

WB Suggested Anti-BRD9 Antibody Titration: 2.5 ug/ml, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate, BRD9 is supported by BioGPS gene expression data to be expressed in Jurkat.