You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb576955 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to BRD4 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | ChIP, IF, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human BRD4 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 152 kDa |
Target | BRD4 |
UniProt ID | O60885 |
Protein Sequence | Synthetic peptide located within the following region: EIEIDFETLKPSTLRELERYVTSCLRKKRKPQAEKVDVIAGSSKMKGFSS |
NCBI | NP_055114 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | CAP, MCAP, HUNK1, HUNKI Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Peptide sequence is contained within Isoform A (152 kDa), Isoform B (88 kDa) and isoform C (80 kDa).
Chromatin Immunoprecipitation (ChIP) Using BRD4 antibody - C-terminal region (orb576955) and HCT116 Cells.
Host: Rabbit, Target Name: BRD4, Sample Tissue: Human 293T Whole Cell, Antibody Dilution: 1 ug/ml.
Host: Rabbit, Target Name: BRD4, Sample Tissue: Human A549 Whole Cell, Antibody Dilution: 1 ug/ml.
Host: Rabbit, Target Name: BRD4, Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 1 ug/ml.
Sample Type: HeLa, Primary Antibody Dilution: 4 ug/ml, Secondary Antibody: Anti-rabbit Alexa 546, Secondary Antibody Dilution: 2 ug/ml, Gene Name: BRD4.
WB Suggested Anti-BRD4 Antibody Titration: 0.2-1 ug/ml, Positive Control: Human Thymus.
IF, IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating