Bovine IL-1F5 protein

• Catalog Number: orb1215724
• Category: Proteins
• Description: The Bovine IL-36 Receptor Antagonist Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine IL-36 Receptor Antagonist Biotinylated applications are for cell culture. Bovine IL-36 Receptor Antagonist Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Bovine IL-36 Receptor Antagonist Biotinylated Specifications: (Molecular Weight: 17.1 kDa) (Amino Acid Sequence: MVLSGALCFRMKDAALKVLYLHDNQLLAGGLQAGKVIKGEEISVVPNRSLDAKLSPVILGVHGGSQCLSCGTGQEPTLKLEPVNIMELYHSAEKSKKFTFYRRDTGLTSSFESAAYPGWFLCTVPEADQPLQITQLPKDTSWDNPIIDFYFQQCD) (Gene ID: 518514).
• Form/Appearance: Lyophilized
• Purity: 98%
• MW: 17.1 kDa
• Target: IL-1F5
• Entrez: 518514
• Protein Sequence: MVLSGALCFRMKDAALKVLYLHDNQLLAGGLQAGKVIKGEEISVVPNRSLDAKLSPVILGVHGGSQCLSCGTGQEPTLKLEPVNIMELYHSAEKSKKFTFYRRDTGLTSSFESAAYPGWFLCTVPEADQPLQITQLPKDTSWDNPIIDFYFQQCD
• Protein Length: 155
• Source: Yeast
• Storage: -20°C
• Note: For research use only
• Expiration Date: 6 months from date of receipt.