Bovine IL-16 Recombinant Protein

• Catalog Number: orb1820763
• Category: Proteins
• Description: The Bovine IL-16 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine IL-16 applications are for cell culture, ELISA standard, and Western Blot Control. The Bovine IL-16 yeast-derived recombinant protein can be purchased in multiple sizes. Bovine IL-16 Specifications: (Molecular Weight: 13.3 kDa) (Amino Acid Sequence: ATTDLNSSTDSSGSASVTSDVSIESAEATVCTVTLEKTSAGLGFSLEGGKGSLHGDKPLTVNRIFKGLASEQSDTVQPGDEIVHLAGTAMQGLTRFEAWNIIKALPDGPVTIVLRRKSLQSKGTPAAGDP (130)) (Gene ID: 506314).
• Form/Appearance: Lyophilized
• Purity: 98%
• MW: 13.3 kDa
• Target: IL-16
• Entrez: 506314
• Protein Sequence: ATTDLNSSTDSSGSASVTSDVSIESAEATVCTVTLEKTSAGLGFSLEGGKGSLHGDKPLTVNRIFKGLASEQSDTVQPGDEIVHLAGTAMQGLTRFEAWNIIKALPDGPVTIVLRRKSLQSKGTPAAGDP (130)
• Protein Length: 130
• Source: Yeast
• Storage: -20°C
• Note: For research use only
• Expiration Date: 6 months from date of receipt.