Bovine IL-1 beta Recombinant Protein

• Catalog Number: orb1820867
• Category: Proteins
• Description: The Bovine IL-1 beta yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine IL-1 beta applications are for cell culture, ELISA standard, and Western Blot Control. The Bovine IL-1 beta yeast-derived recombinant protein can be purchased in multiple sizes. Bovine IL-1 beta Specifications: (Molecular Weight: 17.7 kDa) (Amino Acid Sequence: APVQSIKCKLQDREQKSLVLASPCVLKALHLLSQEMNREVVFCMSFVQGEERDNKIPVALGIKDKNLYLSCVKKGDTPTLQLEEVDPKVYPKRNMEKRFVFYKTEIKNTVEFESVLYPNWYISTSQIEERPVFLGHFRGGQDITDFRMETLSP) (Gene ID: 281251).
• Form/Appearance: Lyophilized
• Purity: 98%
• MW: 17.7 kDa
• Target: IL-1 beta
• Entrez: 281251
• Protein Sequence: APVQSIKCKLQDREQKSLVLASPCVLKALHLLSQEMNREVVFCMSFVQGEERDNKIPVALGIKDKNLYLSCVKKGDTPTLQLEEVDPKVYPKRNMEKRFVFYKTEIKNTVEFESVLYPNWYISTSQIEERPVFLGHFRGGQDITDFRMETLSP
• Protein Length: 153
• Source: Yeast
• Storage: -20°C
• Alternative names: IL-1F2
• Note: For research use only
• Expiration Date: 6 months from date of receipt.