You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1215715 |
---|---|
Category | Proteins |
Description | The Bovine IL-1 beta Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine IL-1 beta Biotinylated applications are for cell culture. Bovine IL-1 beta Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Bovine IL-1 beta Biotinylated Specifications: (Molecular Weight: 17.7 kDa) (Amino Acid Sequence: APVQSIKCKLQDREQKSLVLASPCVLKALHLLSQEMNREVVFCMSFVQGEERDNKIPVALGIKDKNLYLSCVKKGDTPTLQLEEVDPKVYPKRNMEKRFVFYKTEIKNTVEFESVLYPNWYISTSQIEERPVFLGHFRGGQDITDFRMETLSP) (Gene ID: 281251). |
Form/Appearance | Lyophilized |
Purity | 98% |
MW | 17.7 kDa |
Target | IL-1 beta |
Entrez | 281251 |
Protein Sequence | APVQSIKCKLQDREQKSLVLASPCVLKALHLLSQEMNREVVFCMSFVQGEERDNKIPVALGIKDKNLYLSCVKKGDTPTLQLEEVDPKVYPKRNMEKRFVFYKTEIKNTVEFESVLYPNWYISTSQIEERPVFLGHFRGGQDITDFRMETLSP |
Protein Length | 153 |
Source | Yeast |
Storage | -20°C |
Alternative names | IL-1F2 Read more... |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
Filter by Rating