You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1820921 |
---|---|
Category | Proteins |
Description | The Bovine CCL5 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine CCL5 applications are for cell culture, ELISA standard, and Western Blot Control. The Bovine CCL5 yeast-derived recombinant protein can be purchased in multiple sizes. Bovine CCL5 Specifications: (Molecular Weight: 7.9 kDa) (Amino Acid Sequence: SPYASDTTPCCFAYISRPLPRTHVQEYFYTSSKCSMAAVVFITRKNRQVCANPEKKWVREYINALELS) (Gene ID: 327712). |
Form/Appearance | Lyophilized |
Purity | 98% |
MW | 7.9 kDa |
Target | CCL5 |
Entrez | 327712 |
Protein Sequence | SPYASDTTPCCFAYISRPLPRTHVQEYFYTSSKCSMAAVVFITRKNRQVCANPEKKWVREYINALELS |
Protein Length | 68 |
Source | Yeast |
Storage | -20°C |
Alternative names | RANTES Read more... |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
ELISA, WB | |
Greater than 90% by SDS-PAGE gel analyses | |
28.5 kDa | |
E.Coli |
ELISA, WB | |
Greater than 95% by SDS-PAGE gel analyses | |
9.7 KDa | |
E.Coli |
Filter by Rating