You have no items in your shopping cart.
Cart summary
Bovine CCL5 Recombinant Protein
Catalog Number: orb1820921
| Catalog Number | orb1820921 |
|---|---|
| Category | Proteins |
| Description | The Bovine CCL5 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine CCL5 applications are for cell culture, ELISA standard, and Western Blot Control. The Bovine CCL5 yeast-derived recombinant protein can be purchased in multiple sizes. Bovine CCL5 Specifications: (Molecular Weight: 7.9 kDa) (Amino Acid Sequence: SPYASDTTPCCFAYISRPLPRTHVQEYFYTSSKCSMAAVVFITRKNRQVCANPEKKWVREYINALELS) (Gene ID: 327712). |
| Form/Appearance | Lyophilized |
| Purity | 98% |
| MW | 7.9 kDa |
| Target | CCL5 |
| Entrez | 327712 |
| Protein Sequence | SPYASDTTPCCFAYISRPLPRTHVQEYFYTSSKCSMAAVVFITRKNRQVCANPEKKWVREYINALELS |
| Protein Length | 68 |
| Source | Yeast |
| Storage | -20°C |
| Alternative names | RANTES Read more... |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
Recombinant Bovine Rantes [orb1098879]
ELISA, WB
Greater than 90% by SDS-PAGE gel analyses
28.5 kDa
E.Coli
1 mg, 200 μg, 50 μg, 100 μgBovine Rantes protein [orb753283]
ELISA, WB
Greater than 95% by SDS-PAGE gel analyses
9.7 KDa
E.Coli
100 μg, 1 mg, 200 μg, 50 μg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars
