Bovine CCL4 Recombinant Protein

Catalog Number: orb1820730

Catalog Number	orb1820730
Category	Proteins
Description	The Bovine CCL4 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine CCL4 applications are for cell culture, ELISA standard, and Western Blot Control. The Bovine CCL4 yeast-derived recombinant protein can be purchased in multiple sizes. Bovine CCL4 Specifications: (Molecular Weight: 7.8 kDa) (Amino Acid Sequence: APMGSDPPTACCFSYTLRKIPRNFVNDYFETSSLCSQPAVVFQTKKGRQVCANPSEPWVQEYVDDLELN (69)) (Gene ID: 414347).
Form/Appearance	Lyophilized
Purity	98%
MW	7.8 kDa
Target	CCL4
Entrez	414347
Protein Sequence	APMGSDPPTACCFSYTLRKIPRNFVNDYFETSSLCSQPAVVFQTKKGRQVCANPSEPWVQEYVDDLELN (69)
Protein Length	69
Source	Yeast
Storage	-20°C
Alternative names	MIP-1 beta Read more...
Note	For research use only
Expiration Date	6 months from date of receipt.