Bovine CCL11 protein

Catalog Number: orb1215729

Catalog Number	orb1215729
Category	Proteins
Description	The Bovine CCL11 (Eotaxin-1) Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine CCL11 (Eotaxin-1) Biotinylated applications are for cell culture. Bovine CCL11 (Eotaxin-1) Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Bovine CCL11 (Eotaxin-1) Biotinylated Specifications: (Molecular Weight: 8.6 kDa) (Amino Acid Sequence: QPASIPTICCFNMSKKKISIQRLQSYRKITSSKCPQKAVIFNTKQNKKICVDPQEKWVQNAMEYLNQKSQTLKS) (Gene ID: 404072).
Form/Appearance	Lyophilized
Purity	98%
MW	8.6 kDa
Target	CCL11
Entrez	404072
Protein Sequence	QPASIPTICCFNMSKKKISIQRLQSYRKITSSKCPQKAVIFNTKQNKKICVDPQEKWVQNAMEYLNQKSQTLKS
Protein Length	74
Source	Yeast
Storage	-20°C
Alternative names	Eotaxin-1 Read more...
Note	For research use only
Expiration Date	6 months from date of receipt.