BMPER antibody

• Catalog Number: orb581757
• Category: Antibodies
• Description: Rabbit polyclonal antibody to BMPER
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC-P, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human BMPER
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 76 kDa
• Target: BMPER
• UniProt ID: Q8N8U9
• Protein Sequence: Synthetic peptide located within the following region: NGHKRDDLIGGDGNFKFDVDDFAESWRVESNEFCNRPQRKPVPELCQGTV
• NCBI: NP_597725
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: CV2, CV-2, CRIM3
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/ml of the antibody was used in this experiment.

BMPER was immunoprecipitated from 1 mg HEK293 Whole Cell Lysate with orb581757 with 1:200 dilution. Western blot was performed using orb581757 at 1/1000 dilution, Lane 1: Control IP in HEK293 Whole Cell Lysate, Lane 2: BMPER IP with orb581757 in HEK293 Whole Cell Lysate, Lane 3: Input of HEK293 Whole Cell Lysate.

Host: Rabbit, Target Name: BMPER, Sample Tissue: Human A549 Whole Cell, Antibody dilution: 3 ug/ml.

Human Lung

Human Lung

Immunohistochemistry with Human Lung, respiratory epethelium tissue at an antibody concentration of 5.0 ug/ml using anti-BMPER antibody (orb581757).

WB Suggested Anti-BMPER Antibody Titration: 1 ug/ml, Positive Control: Fetal heart lysate.