You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb574141 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to BMP7 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human BMP7 |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 49 kDa |
Target | BMP7 |
UniProt ID | P18075 |
Protein Sequence | Synthetic peptide located within the following region: QGKHNSAPMFMLDLYNAMAVEEGGGPGGQGFSYPYKAVFSTQGPPLASLQ |
NCBI | NP_001710 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | OP-1 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: BMP7, Sample Type: Human Thyroid, Antibody dilution: 1.0 ug/ml.
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. Recommended dilution for this antibody is 1-3 ug/ml.
Host: Rabbit, Target Name: BMP7, Sample Tissue: Human NCI-H226, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target: BMP7, Positive control (+): 293T (2T), Negative control (-): HepG2 (HG), Antibody concentration: 1 ug/ml.
Human kidney
WB Suggested Anti-BMP7 Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:1562500, Positive Control: Transfected 293T.
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating