You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb316552 |
---|---|
Category | Antibodies |
Description | BMP5 Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | ELISA, FC, IHC, WB |
Reactivity | Human, Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human BMP-5 (332-365aa HQDSSRMSSVGDYNTSEQKQACKKHELYVSFRDL), different from the related mouse sequence by three amino acids. |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 51737 MW |
UniProt ID | P22003 |
Sensitivity | > 5000 cells |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Bone morphogenetic protein 5;BMP-5;BMP5; Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
Flow Cytometry analysis of U20S cells using anti-BMP5 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.
WB analysis of BMP-5 using anti-BMP-5 antibody.Lane 1:Rat Liver Tissue;2:Mouse Liver Tissue;3:A549 Cell.
IHC analysis of BMP-5 using anti-BMP-5 antibody. BMP-5 was detected in a paraffin-embedded section of mouse liver tissue.
IHC analysis of BMP-5 using anti-BMP-5 antibody. BMP-5 was detected in a paraffin-embedded section of rat lung tissue.
IHC analysis of BMP-5 using anti-BMP-5 antibody. BMP-5 was detected in a paraffin-embedded section of human lung cancer tissue.
IF, IH, WB | |
Human, Mouse, Porcine, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating