BMP2 purified MaxPab rabbit polyclonal antibody (D01P)

• Catalog Number: orb2295460
• Category: Antibodies
• Description: Rabbit polyclonal antibody raised against a full-length human BMP2 protein.
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Reactivity: Human
• Immunogen: BMP2 (AAI48690.1, 1 a.a. ~ 396 a.a) full-length human protein.
• Conjugation: Unconjugated
• Protein Sequence: MVAGTRCLLALLLPQVLLGGAAGLVPELGRRKFAAASSGRPSSQPSDEVLSEFELRLLSMFGLKQRPTPSRDAVVPPYMLDLYRRHSGQPGSPAPDHRLERAASRANTVRSFHHEESLEELPETSGKTTRRFFFNLSSIPTEEFITSAELQVFREQMQDALGNNSSFHHRINIYEIIKPATANSKFPVTRLLDTRLVNQNASRWESFDVTPAVMRWTAQGHANHGFVVEVAHLEEKQGVSKRHVRISRSLHQDEHSWSQIRPLLVTFGHDGKGHPLHKREKRQAKHKQRKRLKSSCKRHPLYVDFSDVGWNDWIVAPPGYHAFYCHGECPFPLADHLNSTNHAIVQTLVNSVNSKIPKACCVPTELSAISMLYLDENEKVVLKNYQDMVVEGCGCR
• NCBI: AAI48690.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

BMP2 MaxPab rabbit polyclonal antibody. Western Blot analysis of BMP2 expression in human liver.

Western Blot analysis of BMP2 expression in transfected 293T cell line by BMP2 MaxPab polyclonal antibody. Lane 1: BMP2 transfected lysate(43.56 KDa). Lane 2: Non-transfected lysate.