BID purified MaxPab rabbit polyclonal antibody (D01P)

• Catalog Number: orb2295504
• Category: Antibodies
• Description: Rabbit polyclonal antibody raised against a full-length human BID protein.
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: PLA, WB
• Reactivity: Human
• Immunogen: BID (NP_001187.1, 1 a.a. ~ 195 a.a) full-length human protein.
• Conjugation: Unconjugated
• Protein Sequence: MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD
• NCBI: NP_001187.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

BID MaxPab rabbit polyclonal antibody. Western Blot analysis of BID expression in Jurkat.

Proximity Ligation Analysis of protein-protein interactions between BID and BAX. HeLa cells were stained with anti-BID rabbit purified polyclonal 1:1200 and anti-BAX mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

Western Blot analysis of BID expression in transfected 293T cell line by BID MaxPab polyclonal antibody. Lane 1: BID transfected lysate(22.00 KDa). Lane 2: Non-transfected lysate.