BHLHE40 antibody

• Catalog Number: orb324508
• Category: Antibodies
• Description: Rabbit polyclonal antibody to BHLHE40
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human BHLHB2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 45 kDa
• Target: BHLHE40
• UniProt ID: O14503
• Protein Sequence: Synthetic peptide located within the following region: SEKGDLRSEQPCFKSDHGRRFTMGERIGAIKQESEEPPTKKNRMQLSDDE
• NCBI: NP_003661
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti DEC1 antibody, anti SHARP-2 antibody, anti ST
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of Transfected 293T tissue using BHLHE40 antibody

Immunohistochemical staining of human Lung tissue using BHLHE40 antibody

Western blot analysis of human Fetal Lung tissue using BHLHE40 antibody

Western blot analysis of human Placenta tissue using BHLHE40 antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/mL of the antibody was used in this experiment.

Host: Rabbit, Target Name: BHLHB2, Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/mL.

Host: Rabbit, Target Name: BHLHB2, Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/mL.

Rabbit Anti-BHLHE40 Antibody, Paraffin Embedded Tissue: Human alveolar cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.

WB Suggested Anti-BHLHB2 Antibody Titration: 0.2-1 ug/mL, Positive Control: Transfected 293T.