Cart summary

You have no items in your shopping cart.

    Beta Tubulin/TUBB Antibody

    Catalog Number: orb389435

    DispatchUsually dispatched within 5-10 working days
    $ 520.00
    Catalog Numberorb389435
    CategoryAntibodies
    DescriptionBeta Tubulin/TUBB Antibody
    Species/HostRabbit
    ClonalityPolyclonal
    Tested applicationsFC, ICC, IF, IHC, WB
    ReactivityGallus, Human, Monkey, Mouse, Rat
    IsotypeRabbit IgG
    ImmunogenA synthetic peptide corresponding to a sequence at the C-terminus of human Beta Tubulin (383-412aa EQFTAMFRRKAFLHWYTGEGMDEMEFTEAE), identical to the related mouse and rat sequences.
    ConcentrationAdding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
    Form/AppearanceLyophilized
    ConjugationUnconjugated
    MW50433 MW
    UniProt IDP07437
    StorageStore at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
    Alternative namesTubulin beta chain; Tubulin beta-5 chain; TUBB; TU
    Read more...
    NoteFor research use only
    Application notesTested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
    Expiration Date12 months from date of receipt.
    Beta Tubulin/TUBB Antibody

    Flow Cytometry analysis of U20S cells using anti-Beta Tubulin antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

    Beta Tubulin/TUBB Antibody

    Flow Cytometry analysis of SiHa cells using anti-Beta Tubulin antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

    Beta Tubulin/TUBB Antibody

    WB analysis of Beta III Tubulin using anti-Beta III Tubulin antibody.Lane 1:human HeLa cell; 2:human SH-SY5Y cell; 3:human HepG2 cell; 4:rat brain tissue; 5:rat C6 cell; 6:mouse brain tissue; 7:mouse 3T3-L1 cell.

    Beta Tubulin/TUBB Antibody

    IHC analysis of Beta III Tubulin using anti-Beta III Tubulin antibody. Beta III Tubulin was detected in paraffin-embedded section of human mammary cancer tissues.

    Beta Tubulin/TUBB Antibody

    IHC analysis of Beta III Tubulin using anti-Beta III Tubulin antibody. Beta III Tubulin was detected in paraffin-embedded section of human glioma tissues.

    • Beta Tubulin TUBB Antibody (monoclonal, 2E11) [orb610920]

      FC,  ICC,  IF,  WB

      Human, Mouse, Rat

      Mouse

      Monoclonal

      Unconjugated

      10 μg, 100 μg
    • beta Tubulin TUBB Rabbit Monoclonal Antibody [orb548384]

      FC,  ICC,  IF,  IHC,  WB

      Human, Mouse, Rat

      Rabbit

      Monoclonal

      Unconjugated

      30 μl, 100 μl
    • TUBB antibody [orb373011]

      WB

      Human, Mouse, Rat

      Polyclonal

      Unconjugated

      100 μl, 50 μl, 200 μl
    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars