beta 1 Adrenergic Receptor antibody

• Catalog Number: orb329873
• Category: Antibodies
• Description: Rabbit polyclonal antibody to beta 1 Adrenergic Receptor
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Canine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat
• Reactivity: Canine, Guinea pig, Human, Mouse, Porcine, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ADRB1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 51 kDa
• Target: ADRB1
• UniProt ID: P08588
• Protein Sequence: Synthetic peptide located within the following region: CTVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASS
• NCBI: NP_000675
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti-ADR B1 antibody, anti-ADRB 1 antibody, anti-A
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of human brain tissue using ADRB1 antibody

Western blot analysis of Wild type mouse, left ventricle tissue using ADRB1 antibody

Western blot analysis of human Placenta tissue using ADRB1 antibody

Western blot analysis of human Fetal Heart tissue using ADRB1 antibody

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment.

Host: Rabbit, Target Name: ADRB1, Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 1 ug/mL.

Host: Rabbit, Target Name: ADRB1, Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/mL.

Host: Rabbit, Target Name: ADRB1, Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/mL.

Host: Rabbit, Target Name: ADRB1, Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/mL.

Host: Rabbit, Target Name: ADRB1, Sample Type: Human Fetal Muscle, Antibody Dilution: 1.0 ug/mL.

Host: Rabbit, Target: ADRB1, Positive control (+): Mouse liver (M-LI), Negative control (-): Mouse spleen (M-SP), Antibody concentration: 1 ug/mL.

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 0.5, 5, and 50 ug/mL. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for either two or three concentrations were averaged and results and standard deviation are shown.

WB Suggested Anti-ADRB1 Antibody, Positive Control: Lane 1: 20 ug Wild type mouse, left ventricle Lane 2: 20 ug Transgenic mouse, treated with experimental drug, left ventricle Lane 3: 20 ug HepG2 lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Goat anti rabbit-HRP, Secondry Antibody Dilution: 1:5000.

WB Suggested Anti-ADRB1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Human brain.