BDNF purified MaxPab mouse polyclonal antibody (B01P)

• Catalog Number: orb2295524
• Category: Antibodies
• Description: Mouse polyclonal antibody raised against a full-length human BDNF protein.
• Species/Host: Mouse
• Clonality: Polyclonal
• Tested applications: WB
• Reactivity: Human, Mouse
• Immunogen: BDNF (AAH29795, 1 a.a. ~ 247 a.a) full-length human protein.
• Conjugation: Unconjugated
• Protein Sequence: MTILFLTMVISYFGCMKAAPMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLADTFEHMIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYKTKCNPMGYAKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR
• NCBI: AAH29795
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

BDNF MaxPab polyclonal antibody. Western Blot analysis of BDNF expression in NIH/3T3.

Western Blot analysis of BDNF expression in transfected 293T cell line by BDNF MaxPab polyclonal antibody. Lane 1: BDNF transfected lysate(27.28 KDa). Lane 2: Non-transfected lysate.