BDNF Rabbit Polyclonal Antibody

• Catalog Number: orb578294
• Category: Antibodies
• Description: Rabbit polyclonal antibody to BDNF
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Canine, Equine, Porcine, Rabbit, Rat
• Reactivity: Human, Monkey, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human BDNF
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 28 kDa
• Target: BDNF
• UniProt ID: P23560
• Protein Sequence: Synthetic peptide located within the following region: EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG
• NCBI: NP_001700
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: ANON2, BULN2
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.The canonical isoform of 28 kDa is present as well as a second isoform around 37 kDa. Several isoforms of similar size contain this peptide sequence.

Sample Tissue: Mouse Brain, Antibody Dilution: 1 ug/ml.

Sample Tissue: Mouse Pancreas, Antibody Dilution: 1 ug/ml.

Sample Tissue: Mouse Testis, Antibody Dilution: 1 ug/ml.

Sample Tissue: Human 786-0 Whole Cell, Antibody Dilution: 3 ug/ml.

Sample Tissue: Human ACHN, Antibody Dilution: 1.0 ug/ml.

Sample Tissue: Human HT1080 Whole Cell, Antibody Dilution: 1 ug/ml.

Sample Tissue: Human MCF7 Whole Cell, Antibody Dilution: 1 ug/ml.

Sample Tissue: Human Ovary Tumor, Antibody Dilution: 1 ug/ml.

Sample Tissue: Human PANC1 Whole Cell, Antibody Dilution: 3 ug/ml.

Sample Type: ACHN Whole Cell lysates, Antibody Dilution: 1.0 ug/ml.

Sample Type: ACHN Whole Cell lysates, Antibody Dilution: 1 ug/ml.

Sample Type: Fetal Liver lysates, Antibody Dilution: 0.5 ug/ml.

Sample Type: Rhesus macaque spinal cord, Primary Antibody Dilution: 1:300, Secondary Antibody: Donkey anti Rabbit 488, Secondary Antibody Dilution: 1:500, Color/Signal Descriptions: Green: BDNF, Gene Name: BDNF.

Sample Type: Ventral horn region of mouse spinal cord, Primary Antibody Dilution: 1:200, Secondary Antibody: Donkey anti-rabbit CY2, Secondary Antibody Dilution: 1:500, Color/Signal Descriptions: Green:BDNF, Gene Name: BDNF.

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/ml in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.

WB Suggested Anti-BDNF Antibody Titration: 0.2-1 ug/ml, Positive Control: Human Liver.