You have no items in your shopping cart.
Cart summary
Item 1 of 1
BDKRB2 polyclonal antibody (A01)
Catalog Number: orb2295526
| Catalog Number | orb2295526 |
|---|---|
| Category | Antibodies |
| Description | Mouse polyclonal antibody raised against a partial recombinant BDKRB2. |
| Species/Host | Mouse |
| Clonality | Polyclonal |
| Tested applications | ELISA, WB |
| Reactivity | Human |
| Immunogen | BDKRB2 (NP_000614, 1 a.a. ~ 60 a.a) partial recombinant protein with GST tag. |
| Conjugation | Unconjugated |
| Protein Sequence | MFSPWKISMFLSVREDSVPTTASFSADMLNVTLQGPTLNGTFAQSKCPQVEWLGWLNTIQ |
| NCBI | NP_000614 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | 50 % glycerol |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
Western Blot detection against Immunogen (32.71 KDa).
