You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb584729 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to Bco2 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Canine, Equine, Guinea pig, Human, Rat |
Reactivity | Mouse |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 60kDa |
Target | Bco2 |
UniProt ID | Q99NF1 |
Protein Sequence | Synthetic peptide located within the following region: CYNIIRVPPKKKEPGETIHGAQVLCSIASTEKMKPSYYHSFGMTKNYIIF |
NCBI | NP_573480 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | CMO, Bcdo, Bcmo, CMO2, B-dio, Bcdo2, Bcmo2, B-diox Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
WB Suggested Anti-Bco2 Antibody, Titration: 1.0 ug/ml, Positive Control: Mouse Kidney.
Filter by Rating