You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb581584 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to BCKDK |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human BCKDK |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 43kDa |
Target | BCKDK |
UniProt ID | O14874 |
Protein Sequence | Synthetic peptide located within the following region: CLPFIIGCNPTILHVHELYIRAFQKLTDFPPIKDQADEAQYCQLVRQLLD |
NCBI | NP_005872 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | BDK, BCKDKD Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Rabbit Anti-BCKDK antibody, Formalin Fixed Paraffin Embedded Tissue: Human Colon, Submucosal Plexus, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.
Rabbit Anti-BCKDK antibody, Formalin Fixed Paraffin Embedded Tissue: Human Testis, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-BCKDK Antibody Titration: 0.2-1 ug/ml, Positive Control: Human brain.
ELISA, FC, ICC, IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IH, WB | |
Human, Mouse, Porcine, Primate, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating