You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb389460 |
---|---|
Category | Antibodies |
Description | Bax Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | FC, IHC, WB |
Reactivity | Human, Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human Bax (17-48aa EQIMKTGALLLQGFIQDRAGRMGGEAPELALD), different from the related mouse and rat sequences by five amino acids. |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 21184 MW |
UniProt ID | Q07812 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Apoptosis regulator BAX;Bcl-2-like protein 4;Bcl2- Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
Flow Cytometry analysis of A549 cells using anti-Bax antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.
WB analysis of Bax using anti-Bax antibody.Lane 1:rat thymus tissue;2:mouse thymus tissue;3:HEPA1-6 cell;4:HELA cell;5:MCF-7 cell.
IHC analysis of Bax using anti-Bax antibody.Bax was detected in paraffin-embedded section of human lung cancer tissues.
IHC analysis of Bax using anti-Bax antibody.Bax was detected in paraffin-embedded section of rat intestine tissues.
IHC analysis of Bax using anti-Bax antibody.Bax was detected in paraffin-embedded section of human intetsinal cancer tissues.
IHC analysis of Bax using anti-Bax antibody.Bax was detected in paraffin-embedded section of mouse intestine tissues.
FC, ICC, IHC-P, WB | |
Bovine, Canine, Porcine, Sheep | |
Human, Mouse, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating