BAG5 antibody

• Catalog Number: orb331160
• Category: Antibodies
• Description: Rabbit polyclonal antibody to BAG5
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rat
• Reactivity: Human
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 56kDa
• Target: BAG5
• UniProt ID: Q9UL15
• Protein Sequence: Synthetic peptide located within the following region: LEKRKLFACEEHPSHKAVWNVLGNLSEIQGEVLSFDGNRTDKNYIRLEEL
• NCBI: NP_001015049
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti BAG-5 antibody
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target Name: BAG5, Sample Type: Human Hela, Antibody dilution: 1.0 ug/ml. BAG5 is supported by BioGPS gene expression data to be expressed in HeLa.

Sample Type: Lane 1: 20 ug siRUVBL1 transfected human Saos2 cells, Lane 2: 20 ug untransfected human Saos2 cells Primary Antibody dilution: 1:1000 Secondary Antibody: Anti-rabbit-HRP Secondary Antibody dilution: 1:3000 Color/Signal Descriptions: BAG5.

WB Suggested Anti-BAG5 Antibody, Titration: 1.0 ug/ml, Positive Control: Fetal Liver.