You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb325951 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to BABAM1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human C19orf62 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 36kDa |
Target | BABAM1 |
UniProt ID | Q9NWV8 |
Protein Sequence | Synthetic peptide located within the following region: DRAVGAQASVGSRSEGEGEAASADDGSLNTSGAGPKSWQVPPPAPEVQIR |
NCBI | NP_054892 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti FLJ20571 antibody, anti HSPC142 antibody, ant Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
WB Suggested Anti-C19orf62 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:1562500, Positive Control: Hela cell lysate, BABAM1 is supported by BioGPS gene expression data to be expressed in HeLa.
FC, IHC-P, WB | |
Bovine, Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IHC-P, WB | |
Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating